Analytical Data
-
Gene name
HGF
- Application
-
Alternative Names
HGF；HPTA；Hepatocyte growth factor
-
Species
Pig
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
F1SB93
-
Expression Region
1-310 aa
-
AA Sequence
MWVTKLLQVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLINEDPLLKIKTKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECLTCNGESYRGPMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPMETTECIQGQG
-
Molecular Weight
33.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Hepatocyte Growth Factor (HGF), a multifunctional protein primarily produced by mesenchymal cells, plays a crucial role in various biological processes, including cell proliferation, migration, and differentiation. Originally identified for its role in liver regeneration, HGF has garnered significant attention due to its involvement in tumorigenesis and cancer progression. As a potent mitogen, HGF interacts with its receptor, c-Met, triggering intracellular signaling pathways that promote not only normal tissue repair but also pathological conditions such as metastasis. Research on recombinant HGF protein has expanded in recent years, focusing on its therapeutic potential in liver diseases, wound healing, and as an anti-cancer agent. Advanced biotechnological methods have enabled the production of high-quality recombinant HGF, allowing for detailed studies into its mechanistic pathways and clinical applications. As the understanding of HGF's role in various physiological and pathological processes deepens, it emerges as a promising candidate for targeted therapy, warranting further exploration in preclinical and clinical settings. The evolution of HGF recombinant protein research reflects the growing interest in leveraging growth factors for therapeutic interventions in regenerative medicine and oncology.
