Cat: PA1000-1614

Recombinant Human IL18BP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL18BP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL18BP;Interleukin-18-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95998

  • Expression Region

    31-194aa

  • AA Sequence

    ADPTPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVP LNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTG TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLP PTQEALPSSHSSPQQQGLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-18 binding protein (IL-18BP) is a crucial regulatory protein that modulates the activity of interleukin-18 (IL-18), a pro-inflammatory cytokine involved in various immune responses. Elevated IL-18 levels have been associated with several inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis, highlighting the need for effective therapeutic strategies to regulate its activity. IL-18BP acts by binding to IL-18, preventing it from interacting with its receptor and, consequently, inhibiting IL-18-mediated signaling pathways. This modulation is pivotal in controlling excessive inflammation and tissue damage. The recombinant form of IL-18BP has garnered significant attention in recent years as a potential therapeutic agent due to its ability to mitigate inflammatory responses in preclinical models. Researchers have been investigating its efficacy in various pathological contexts, focusing on its role in improving outcomes in diseases characterized by dysregulated IL-18 signaling. Understanding the structure-function relationship of IL-18BP and exploring its application in combination therapies may pave the way for novel anti-inflammatory treatments. Additionally, studies have been focusing on optimizing recombinant production methods to enhance yield and biological activity, further supporting its development as a therapeutic protein. Overall, IL-18BP represents a promising avenue for therapeutic intervention in diseases driven by IL-18-mediated inflammation, opening new possibilities for managing chronic inflammatory conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US