Cat: PA2000-4413

Recombinant Human SERPINI1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SERPINI1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SERPINI1;PI12;Neuroserpin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99574

  • Expression Region

    17-410aa

  • AA Sequence

    TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQG STQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQN GFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDL VSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPM MYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLAT LEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIF IKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVL YPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SERPINI1, also known as Serpin Peptidase Inhibitor, clade I, member 1, is a member of the serpin superfamily, which serves as an essential regulatory component in various physiological processes, including protease inhibition, inflammation, and coagulation. Research has demonstrated that SERPINI1 plays a crucial role in several diseases, particularly neurodegenerative disorders and certain cancers, where it may influence tumor progression and metastasis. Its dysregulation has been associated with impaired protease activity, leading to altered homeostasis and exacerbated pathological conditions. Given its significance, the recombinant production of SERPINI1 protein has emerged as a valuable tool for understanding its biological functions and potential therapeutic applications. The development of recombinant SERPINI1 paves the way for in-depth studies regarding its structure-function relationships, and enables high-throughput screening of potential inhibitors or modulators. Furthermore, elucidating the mechanisms underlying SERPINI1's involvement in disease processes may inform the design of innovative therapeutic strategies aimed at restoring its normal function or targeting the pathways it regulates. As such, the study of recombinant SERPINI1 protein not only holds promise for advancing our understanding of serpin biology but also represents a step towards novel interventions in SERPINI1-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US