Analytical Data
-
Gene name
TNFRSF11A
- Application
-
Alternative Names
TNFRSF11A；RANK；Tumor necrosis factor receptor superfamily member 11A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6Q6
-
Expression Region
30-212aa
-
AA Sequence
IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
-
Molecular Weight
50.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The TNFRSF11A gene, also known as receptor activator of nuclear factor kappa-B (RANK), plays a crucial role in regulating bone metabolism, immune response, and the development of various diseases, including osteoporosis and certain cancers. Its protein product is a member of the tumor necrosis factor receptor superfamily and is primarily expressed on osteoclasts, which are essential for bone resorption. Research on TNFRSF11A recombinant proteins has gained momentum as scientists seek to understand the mechanisms by which RANK signaling influences osteoclast differentiation and activity. Additionally, TNFRSF11A has been implicated in the pathophysiology of autoimmune disorders, making it a potential therapeutic target for modulating immune responses. Recombinant RANK proteins are utilized in various experimental settings to study their interactions with ligands such as RANKL (RANK Ligand) and their subsequent effects on cell signaling pathways. Understanding the structure-function relationship of TNFRSF11A is vital for developing drugs that can either inhibit or stimulate its activity, offering promising avenues for treating bone-related diseases and immune disorders. The generation of TNFRSF11A recombinant proteins enables extensive research into its biological functions and therapeutic applications, advancing the scientific community's knowledge of this critical protein in health and disease.
