Analytical Data
-
Gene name
TAZ
- Application
-
Alternative Names
TAZ；EFE2；G4.5；TAZ；Tafazzin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16635
-
Expression Region
1-262aa
-
AA Sequence
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYP CPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGD GVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPG DGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPR FGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQ AEQLHNHLQPGR
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAZ (tezolizumab-associated protein) is a significant player in the field of cellular signaling and gene regulation, particularly known for its role in the Hippo signaling pathway. This pathway is crucial for controlling cell proliferation and survival, thus influencing tissue growth and organ size. Dysregulation of TAZ has been implicated in various diseases, including cancer, where its overactivity can lead to unchecked cell growth and tumorigenesis. Recent studies have highlighted TAZ's interactions with transcription factors and its involvement in stem cell maintenance and differentiation. Researchers are increasingly interested in TAZ not only for its biological functions but also for its potential as a therapeutic target. By understanding the molecular mechanisms that govern TAZ activity, scientists aim to develop strategies to manipulate its function for disease treatment. Furthermore, TAZ reorganization in response to mechanical signals and environmental cues is an emerging area of investigation, linking cellular mechanics to gene expression. This integrated approach enhances our understanding of how TAZ contributes to both normal physiology and pathological conditions, positioning it as a critical focus in the development of novel therapeutics and interventions in regenerative medicine and cancer therapy.
