Analytical Data
-
Gene name
IFNA14
- Application
-
Alternative Names
IFNA14;Interferon alpha-14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01570
-
Expression Region
24-189aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRIS PFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSA AWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQ RITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFNA14, a member of the interferon-alpha (IFN-α) family, plays a crucial role in the immune response against viral infections. This protein, known for its antiviral, antiproliferative, and immunomodulatory functions, is expressed in response to viral stimuli and has been extensively studied for its therapeutic potential in treating viral diseases, certain cancers, and autoimmune disorders. The interest in IFNA14 is particularly significant due to its ability to induce the transcription of various genes involved in the antiviral response, enhance natural killer cell activity, and modulate adaptive immune responses. Recent advancements in recombinant DNA technology have enabled the production of IFNA14 as a recombinant protein, facilitating detailed functional studies and the exploration of its therapeutic applications. Researchers have been investigating various aspects of IFNA14, including its structure, signaling pathways, and interaction with receptors to better understand its role in the immune system. Moreover, the comparison of IFNA14’s efficacy and mechanisms with other interferons may yield valuable insights into optimizing its use in clinical settings. Given the rising incidence of viral infections and the need for effective therapies, the ongoing research on IFNA14 provides a promising avenue for the development of novel antiviral treatments and immunotherapeutic strategies.
