Cat: PA1000-1560

Recombinant Human IFIT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IFIT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFIT3;CIG-49;IFI60;IFIT4;Interferon-induced Protein with tetratricopeptide repeats 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14879

  • Expression Region

    1-490aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSEVTKNSLEKILPQLKCHFTWNLFKE DSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLRQA EELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKF SNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLA IAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGE QFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYL YHQIGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLN PLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQRYCNLQKYNGKSEDT AVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQ NGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSS SPRELLSNSEQLN

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The IFIT3 (Interferon-Inducible Protein 3) is a member of the IFIT family of proteins that play critical roles in the innate immune response, particularly in the defense against viral infections. Emerging research highlights its significance in recognizing and binding to viral RNA, thereby inhibiting viral replication and influencing various signaling pathways associated with immune responses. The upregulation of IFIT3 in response to type I interferons underscores its importance during viral challenges, as it contributes to the establishment of an antiviral state within host cells. Investigations into the structural characteristics of IFIT3 have revealed its ability to interact with a variety of viral components, positioning it as a potential biomarker for viral infections and a candidate for therapeutic intervention. Moreover, the relevance of IFIT3 extends beyond virology; studies suggest its involvement in cancer immunity and autoimmune disorders, indicating a broader significance in health and disease. As researchers continue to explore the multifaceted roles of IFIT3 in pathogen recognition and immune modulation, recombinant IFIT3 protein is increasingly utilized in experimental settings to elucidate its mechanism of action and therapeutic potential. Understanding its function may pave the way for innovative strategies in vaccine development and antiviral therapies, particularly in the context of emerging viral pathogens.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US