Analytical Data
-
Gene name
IFI30
- Application
-
Alternative Names
IFI30;GILT;IP30;Gamma-interferon-inducible lysosomal thiol reductase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13284
-
Expression Region
58-232aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMNAPLVNVTLYYEALCGGCRAFLIREL FPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACV LDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDR GMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFI30, also known as Interferon-gamma-inducible protein 30, is a protein that plays a significant role in the immune response, particularly in the context of antimicrobial activity and the regulation of inflammation. Its expression is predominantly induced by interferon-gamma (IFN-γ) and is associated with various immune-related processes. Studies have established that IFI30 is involved in the modulation of innate immune responses, specifically in macrophages and dendritic cells, enhancing their ability to combat pathogens. Additionally, IFI30 has been implicated in the regulation of autophagic processes and the presentation of antigens, influencing the adaptive immune response. Given its critical role in immunity, IFI30 has gained attention as a potential therapeutic target for infectious diseases and inflammatory disorders. Research into recombinant IFI30 involves expressing and purifying the protein in various systems to study its structure-function relationships and explore its potential applications in immunotherapy and vaccine development. Understanding the precise mechanisms through which IFI30 exert its effects could facilitate the design of novel strategies to enhance immune responses against pathogens or to modulate inflammatory conditions, highlighting its importance in both basic and applied biomedical research.
