Analytical Data
-
Gene name
IER3
- Application
-
Alternative Names
IER3;DIF2;IEX1;PRG1;Radiation-inducible immediate-early gene IEX-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46695
-
Expression Region
1-82aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMCHSRSCHPTMTILQAPTPAPSTIPGP RRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPV EEPNP
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IER3 (Immediate Early Response 3) is a gene that plays a significant role in various cellular processes, including stress response, apoptosis, and cell proliferation. Its protein product is implicated in modulating inflammatory responses and has been associated with several diseases, including cancer and autoimmune disorders. Research on IER3 has gained momentum due to its potential as a therapeutic target and biomarker in various pathological conditions. The gene is rapidly upregulated in response to a variety of stimuli, showcasing its role as an immediate early gene that forms part of the cellular response to external stressors. Studies have demonstrated that IER3 can exert anti-apoptotic effects, influencing cell survival and proliferation. Consequently, understanding the molecular mechanisms governing IER3 expression and function is critical for uncovering its role in disease pathogenesis and therapeutic applications. Recent advancements in recombinant protein technology have enabled the production and characterization of IER3 protein, facilitating investigations into its structure-function relationships and interactions with other cellular molecules. This progress has opened up new avenues for exploring the biological significance of IER3, ultimately aiming to exploit its properties for innovative treatments in disease management.











