Cat: PA1000-1558

Recombinant Human IER3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IER3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IER3;DIF2;IEX1;PRG1;Radiation-inducible immediate-early gene IEX-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P46695

  • Expression Region

    1-82aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMCHSRSCHPTMTILQAPTPAPSTIPGP RRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPV EEPNP

  • Molecular Weight

    11 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IER3 (Immediate Early Response 3) is a gene that plays a significant role in various cellular processes, including stress response, apoptosis, and cell proliferation. Its protein product is implicated in modulating inflammatory responses and has been associated with several diseases, including cancer and autoimmune disorders. Research on IER3 has gained momentum due to its potential as a therapeutic target and biomarker in various pathological conditions. The gene is rapidly upregulated in response to a variety of stimuli, showcasing its role as an immediate early gene that forms part of the cellular response to external stressors. Studies have demonstrated that IER3 can exert anti-apoptotic effects, influencing cell survival and proliferation. Consequently, understanding the molecular mechanisms governing IER3 expression and function is critical for uncovering its role in disease pathogenesis and therapeutic applications. Recent advancements in recombinant protein technology have enabled the production and characterization of IER3 protein, facilitating investigations into its structure-function relationships and interactions with other cellular molecules. This progress has opened up new avenues for exploring the biological significance of IER3, ultimately aiming to exploit its properties for innovative treatments in disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US