Analytical Data
-
Gene name
IRX2
- Application
-
Alternative Names
Homeodomain protein IRXA2; Iroquois homeobox 2; Iroquois homeobox protein 2; Iroquois-class homeodomain protein irx-2; IRX 2; irx2; IRX2_HUMAN; IrxA2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZI1
-
Expression Region
1-471aa
-
AA Sequence
MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL
-
Molecular Weight
75.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IRX2, a member of the Iroquois homeobox gene family, plays a crucial role in various developmental and physiological processes, particularly in the regulation of neural and immune system development. Its expression patterns have been linked to important functions in the differentiation of specific cell types and the modulation of inflammatory responses. Research on IRX2 has gained momentum due to its emerging significance in tumor biology and immune regulation, suggesting that it might be involved in cancer progression and the tumor microenvironment. Furthermore, the investigation of IRX2 as a recombinant protein has potential therapeutic implications, enabling the study of its functional properties in vitro and in vivo. By elucidating the molecular mechanisms through which IRX2 influences cell behavior and immune responses, scientists aim to uncover novel therapeutic targets for diseases characterized by dysregulated cell growth and immune dysfunction, including various cancers and autoimmune disorders. This research could pave the way for innovative strategies in cancer immunotherapy and regenerative medicine, offering insights into how manipulation of IRX2 activity may enhance treatment efficacy or promote tissue repair. Overall, the study of IRX2 recombinant proteins represents a promising frontier in understanding the complex interplay between developmental biology and disease.
