Cat: PA2000-4374

Recombinant Human CCL21 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCL21

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCL21;SCYA21;C-C motif chemokine 21

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00585

  • Expression Region

    24-134aa

  • AA Sequence

    SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCL21, or Chemokine (C-C motif) ligand 21, is a crucial chemokine that plays a significant role in regulating immune responses, particularly in the migration of T cells and dendritic cells to lymph nodes. Its interaction with the CCR7 receptor is integral for the establishment of immune surveillance and the activation of adaptive immunity. The study of recombinant CCL21 protein stems from its potential therapeutic applications in various diseases, including cancer, autoimmune disorders, and chronic infections. By utilizing recombinant DNA technology, researchers can produce CCL21 in substantial quantities, allowing for detailed investigations into its biological functions and mechanisms of action. Moreover, the characterization of CCL21 can aid in the development of novel immunotherapies aimed at enhancing immune responses or modulating them in pathological conditions. Various studies have demonstrated that CCL21 not only promotes the migration of immune cells but also has implications in angiogenesis and tissue regeneration. Therefore, understanding the structure-function relationships of recombinant CCL21 protein can provide insights into its therapeutic potential and pave the way for innovative treatment strategies. As research progresses, CCL21 may emerge as a promising target for immunotherapy, highlighting the importance of continued exploration of its properties and applications in the field of immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US