Analytical Data
-
Gene name
CCL21
- Application
-
Alternative Names
CCL21；SCYA21；C-C motif chemokine 21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00585
-
Expression Region
24-134aa
-
AA Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL21, or Chemokine (C-C motif) ligand 21, is a crucial chemokine that plays a significant role in regulating immune responses, particularly in the migration of T cells and dendritic cells to lymph nodes. Its interaction with the CCR7 receptor is integral for the establishment of immune surveillance and the activation of adaptive immunity. The study of recombinant CCL21 protein stems from its potential therapeutic applications in various diseases, including cancer, autoimmune disorders, and chronic infections. By utilizing recombinant DNA technology, researchers can produce CCL21 in substantial quantities, allowing for detailed investigations into its biological functions and mechanisms of action. Moreover, the characterization of CCL21 can aid in the development of novel immunotherapies aimed at enhancing immune responses or modulating them in pathological conditions. Various studies have demonstrated that CCL21 not only promotes the migration of immune cells but also has implications in angiogenesis and tissue regeneration. Therefore, understanding the structure-function relationships of recombinant CCL21 protein can provide insights into its therapeutic potential and pave the way for innovative treatment strategies. As research progresses, CCL21 may emerge as a promising target for immunotherapy, highlighting the importance of continued exploration of its properties and applications in the field of immunology.
