Analytical Data
-
Gene name
IQCF1
- Application
-
Alternative Names
IQCF1; IQ domain-containing protein F1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6M8
-
Expression Region
1-205aa
-
AA Sequence
MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE
-
Molecular Weight
50.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The IQCF1 protein, known to play a crucial role in various cellular processes, has garnered significant attention in recent years due to its involvement in cellular signaling and developmental pathways. Research indicates that IQCF1 is associated with the regulation of calcium signaling and its downstream effects in neuronal and muscle tissues, influencing both cell differentiation and proliferation. Its expression has been linked to several physiological conditions, including cardiac function and neurodevelopmental processes, pointing to its potential relevance in both health and disease. Investigations into IQCF1 have revealed that it may interact with various intracellular partners, including calmodulin, which further underscores its importance in calcium-related pathways. Given the increasing prevalence of calcium dysregulation in numerous pathological states, such as neurodegeneration and cardiomyopathy, the study of IQCF1 and its recombinant forms is essential for understanding its functional mechanics. Furthermore, the potential therapeutic implications of manipulating IQCF1 activity make it an attractive target for drug development. Therefore, ongoing research aims to elucidate the structural and functional dynamics of IQCF1, as well as its implications in cellular homeostasis, paving the way for novel interventions in related human diseases.
