Analytical Data
-
Gene name
INTU
- Application
-
Alternative Names
Homolog of inturned (X. tropicalis); INT; intu; Inturned planar cell polarity effector homolog; KIAA1284; PDZ domain containing 6; PDZ domain-containing protein 6; PDZD 6; PDZD6_HUMAN; PDZK6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULD6
-
Expression Region
1-408aa
-
AA Sequence
MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEIELPSSAHTHGERN
-
Molecular Weight
72.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INTU, or Intersectin, is a scaffold protein that plays a crucial role in various cellular processes, including endocytosis, actin cytoskeletal organization, and signaling pathways. Research into INTU has gained momentum due to its significant implications in cell biology and disease progression, particularly in cancer and neurodegenerative disorders. As a multifunctional protein, INTU interacts with various partners, facilitating the assembly of protein complexes that regulate cellular functions. Its involvement in clathrin-mediated endocytosis highlights its importance in cellular uptake mechanisms, impacting nutrient absorption and receptor signaling. Moreover, INTU's function in actin dynamics is critical for maintaining cell shape and facilitating motility. Recent studies have also suggested a regulatory role for INTU in immune responses and neuronal development. The structural complexity of INTU has prompted investigations into its molecular mechanisms and potential as a therapeutic target. Understanding INTU’s structure-function relationships and its pathways can unveil new insights into cellular management and open avenues for innovative treatments in diseases characterized by dysregulated cellular processes. Overall, the study of INTU restructured proteins serves as a promising frontier in unraveling the complexities of cell biology and the etiology of various diseases.
