Analytical Data
-
Gene name
ns8
- Application
-
Alternative Names
ns8;RIBB;RIT;ROC1;GTP-binding Protein Rit1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DTC8
-
Expression Region
16-121aa
-
AA Sequence
FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
-
Molecular Weight
16.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NS8 is a non-structural protein found in certain viruses, notably within the flavivirus family, which includes significant pathogens like the West Nile virus and Zika virus. Research into NS8 has gained momentum due to its potential role in the viral replication cycle and its impact on the host immune response. This protein is implicated in the manipulation of host cellular pathways, which helps the virus evade immune detection and promote viral persistence. Understanding NS8’s function could provide insights into the virus-host interaction mechanisms and uncover novel therapeutic targets. Additionally, given the increasing threat of flavivirus-related diseases globally, characterizing NS8 and its interactions is critical for the development of effective vaccines and antiviral strategies. Recent studies have focused on elucidating the structure and dynamics of NS8, aiming to identify key regions responsible for its function and interaction with host proteins, which may pave the way for innovative interventions against flavivirus infections.











