Cat: PA2000-256DB

Recombinant Human TMSb10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMSb10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMSb10;PTMB10;THYB10;Thymosin beta-10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63313

  • Expression Region

    1-44aa

  • AA Sequence

    MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMSb10 is a recombinant protein derived from the TMSb10 gene, which has garnered significant interest in the fields of molecular biology and biotechnology due to its potential applications in therapeutics and vaccine development. The study of TMSb10 is rooted in the understanding of its role in immune responses, particularly in the context of viral infections and autoimmune diseases. Research has shown that proteins like TMSb10 can exhibit immunomodulatory properties, influencing the activity of immune cells such as T-cells and dendritic cells. These properties make TMSb10 a valuable candidate for the development of novel immunotherapies, as they can enhance or regulate immune responses in a controlled manner. Additionally, the ability to produce TMSb10 as a recombinant protein allows for high yield and purity, facilitating further studies into its mechanisms of action and potential therapeutic applications. Ongoing research aims to elucidate the precise biological functions of TMSb10, explore its interactions with various immune pathways, and assess its efficacy in preclinical models. This work is crucial for advancing our understanding of immune modulation and developing innovative strategies to combat infectious diseases and improve vaccine efficacy, ultimately addressing significant public health challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US