Analytical Data
-
Gene name
TMSb10
- Application
-
Alternative Names
TMSb10；PTMB10；THYB10；Thymosin beta-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63313
-
Expression Region
1-44aa
-
AA Sequence
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMSb10 is a recombinant protein derived from the TMSb10 gene, which has garnered significant interest in the fields of molecular biology and biotechnology due to its potential applications in therapeutics and vaccine development. The study of TMSb10 is rooted in the understanding of its role in immune responses, particularly in the context of viral infections and autoimmune diseases. Research has shown that proteins like TMSb10 can exhibit immunomodulatory properties, influencing the activity of immune cells such as T-cells and dendritic cells. These properties make TMSb10 a valuable candidate for the development of novel immunotherapies, as they can enhance or regulate immune responses in a controlled manner. Additionally, the ability to produce TMSb10 as a recombinant protein allows for high yield and purity, facilitating further studies into its mechanisms of action and potential therapeutic applications. Ongoing research aims to elucidate the precise biological functions of TMSb10, explore its interactions with various immune pathways, and assess its efficacy in preclinical models. This work is crucial for advancing our understanding of immune modulation and developing innovative strategies to combat infectious diseases and improve vaccine efficacy, ultimately addressing significant public health challenges.
