Analytical Data
-
Gene name
HSPB3
- Application
-
Alternative Names
HSPB3;HSP27;HSPL27;Heat shock Protein beta-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12988
-
Expression Region
1-150aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAKIILRHLIEIPVRYQEEFEARGLEDCRL DHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSHFQILLDVVQF LPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLS AVLCHDGILVVEVKDPVGTK
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSPB3 (heat shock protein family B member 3) is a member of the small heat shock protein (sHSP) family, which plays a crucial role in cellular stress responses, protein folding, and protection against aggregation. Recent studies have highlighted the importance of HSPB3 in various cellular processes, including muscle development and maintenance, as well as its involvement in the pathology of neurodegenerative diseases. Specifically, mutations in the HSPB3 gene have been linked to inherited myopathies, underscoring its significance in muscle health. As a result, the production and characterization of recombinant HSPB3 proteins have become an area of great interest in the field of molecular biology and biomedicine. Recombinant HSPB3 proteins serve as valuable tools for investigating the protein’s structure-function relationships, elucidating its mechanism of action in cellular protection, and enabling the exploration of potential therapeutic interventions for diseases where HSPB3 is implicated. The study of HSPB3 can also contribute to a broader understanding of the role of small heat shock proteins in stress response mechanisms, offering insights that may lead to innovative approaches in treating protein misfolding disorders. Thus, research involving HSPB3 recombinant proteins not only advances basic science understanding but also holds promise for clinical applications in regenerative medicine and the management of muscular and neurodegenerative disorders.
