Analytical Data
-
Gene name
HSD17B14
- Application
-
Alternative Names
HSD17B14;DHRS10;SDR3;SDR47C1;17-beta-hydroxysteroid dehydrogenase 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BPX1
-
Expression Region
1-306aa
-
AA Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVV TGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVT QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELN LLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAM TKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQP LGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVD APDIPS
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSD17B14, or hydroxysteroid 17-beta dehydrogenase 14, is an enzyme involved in the metabolism of steroids, particularly in the conversion of androstenedione to testosterone and estrone to estradiol. Recent studies have identified HSD17B14 as a significant player in various physiological and pathological processes, including hormone regulation, reproductive health, and the potential development of certain cancers. Elevated levels of HSD17B14 have been associated with conditions such as breast cancer and other hormone-related tumors, making it a potential biomarker for these diseases. Additionally, genetic studies have linked HSD17B14 polymorphisms to individual variations in hormone levels and susceptibility to hormone-related disorders. Given this context, the recombinant expression of HSD17B14 protein serves as a crucial approach for understanding its structure-function relationship, enzymatic activity, and interactions with other biomolecules. This knowledge could pave the way for the development of specific inhibitors or modulators that target HSD17B14 for therapeutic purposes. Research involving recombinant HSD17B14 can also facilitate the screening of potential drug candidates, elucidating its role in metabolic pathways and enhancing our understanding of its implications in health and disease. Thus, HSD17B14 remains an important focus of biochemical and pharmacological research.
