Analytical Data
-
Gene name
sspP
- Application
-
Alternative Names
sspP；IL8RB；C-X-C chemokine receptor type 2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P81297
-
Expression Region
215-388aa
-
AA Sequence
YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
-
Molecular Weight
27.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSP (sulfated sulfated polysaccharide) is a type of biomolecule that has garnered significant interest in biochemical research due to its various functional properties and potential applications in medicine and biotechnology. The recombination of SSP proteins involves the use of molecular cloning techniques to produce these proteins in heterologous systems, allowing for the detailed study of their structure-function relationships. Research has shown that SSP proteins play crucial roles in cellular processes, including cell signaling, immune response, and tissue repair. Additionally, their unique sulfation patterns may contribute to their interactions with other biomolecules, making them important targets for drug development and therapeutic applications. The production of recombinant SSP proteins not only aids in elucidating their mechanisms of action but also facilitates the development of novel biomaterials for biomedical applications. Current advances in protein expression systems, such as yeast or bacterial models, have enhanced the yield and functionality of these proteins, paving the way for comprehensive investigations into their properties and potential uses. Overall, the research on recombinant SSP proteins holds promise for innovations in health care, particularly in the fields of regenerative medicine and targeted therapy.
