Analytical Data
-
Gene name
COL11a1
- Application
-
Alternative Names
COL11a1；COLL6；Collagen alpha-1(XI) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12107
-
Expression Region
532-699aa
-
AA Sequence
GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
-
Molecular Weight
47.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL11A1, a member of the collagen family, is crucial for the structural integrity of various tissues, particularly in cartilage and the extracellular matrix. Its relevance has gained attention due to its involvement in developmental processes and its potential role in various pathological conditions. Recent studies indicate that alterations in COL11A1 expression are linked to diseases such as osteoarthritis, fibrotic disorders, and certain cancers, making it a target for therapeutic research. The study of recombinant COL11A1 protein provides a valuable tool for understanding its biological functions and interactions at the molecular level. By producing this protein in vitro, researchers can investigate its role in cellular processes, tissue engineering applications, and the mechanisms behind its association with disease, paving the way for novel diagnostic and therapeutic strategies.
