Analytical Data
-
Gene name
IL17E
- Application
-
Alternative Names
IL 17E; IL 25; IL-17E; IL-25; IL17e; IL25; IL25_HUMAN; Interleukin 17E ; Interleukin 25 ; Interleukin-17E; Interleukin-25; Interleukin17E
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H293
-
Expression Region
1-177aa
-
AA Sequence
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
-
Molecular Weight
46.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-17E, also known as IL-25, is a member of the interleukin-17 cytokine family and plays a significant role in immune regulation and inflammation. It is primarily produced by various immune cells, including mast cells and T helper 2 (Th2) cells, and is involved in the promotion of type 2 immune responses. Research has shown that IL-17E can enhance the production of other cytokines like IL-4, IL-5, and IL-13, which are crucial for the activation of eosinophils and basophils, leading to allergic inflammation and responses associated with asthma and other allergic diseases. The role of IL-17E in the immunopathology of these conditions has garnered interest, prompting investigations into its potential as a therapeutic target. Recombinant IL-17E protein has been produced to facilitate studies on its functions and mechanisms. Understanding the structure and activity of IL-17E may provide insights into its potential applications in treating allergic disorders and other diseases characterized by type 2 inflammation. Moreover, the exploration of IL-17E as a biomarker for allergic diseases holds promise for advancing diagnostic methods. Overall, IL-17E recombinant protein research seeks to elucidate its multifaceted roles in immune responses and explore its therapeutic potential in various inflammatory and allergic conditions.
