Analytical Data
-
Gene name
IL17R
- Application
-
Alternative Names
CANDF5; CD217; CD217 antigen; CDw217; CTLA8; HIL 17R; hIL17R; I17RA_HUMAN; IL 17 receptor A; IL 17 receptor; IL 17RA; IL-17 receptor A; IL-17RA; IL17; IL17A receptor; IL17R; IL17RA
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96F46
-
Expression Region
33-132aa
-
AA Sequence
LRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFL
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-17 receptor (IL-17R) is a pivotal component of the immune system, mediating the effects of interleukin-17 (IL-17), a pro-inflammatory cytokine involved in various immune responses and inflammatory diseases. Research on IL-17R has gained prominence due to its implication in autoimmune diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis. IL-17R signaling stimulates the production of several pro-inflammatory cytokines, chemokines, and other mediators, contributing to the pathogenesis of these conditions. The detailed understanding of IL-17R interactions at the molecular level has provided insights into potential therapeutic strategies, including the development of IL-17 antagonists that can mitigate inflammation and disease progression. Furthermore, advancements in recombinant protein technology have enabled the production of IL-17R as a research tool, allowing scientists to study its structure, function, and role in immune signaling pathways. The elucidation of IL-17R's biological functions offers promising avenues for novel drug discovery and the development of targeted therapies aimed at modulating immune responses in disease states. As research continues to unravel the complexities of IL-17R signaling, it holds great potential for therapeutic innovation in combating systemic inflammatory diseases.
