Cat: PA2000-224DB

Recombinant Human COL9a1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COL9a1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COL9a1;Collagen alpha-1(IX) chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20849

  • Expression Region

    24-328aa

  • AA Sequence

    AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRA IQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGST LKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLS SLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKL ADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGE QGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPG ADTSPVDHHHHHH

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COL9A1, a gene encoding the alpha-1 chain of type IX collagen, plays a pivotal role in cartilage structure and function, particularly within the extracellular matrix (ECM) of articular cartilage. Type IX collagen is a heterotrimeric molecule that interacts with type II collagen and proteoglycans, contributing to the biomechanical properties of cartilage and facilitating cell-matrix interactions. Research has shown that mutations in the COL9A1 gene are associated with various cartilage-related disorders, such as osteoarthritis and multiple epiphyseal dysplasia. Given the importance of COL9A1 in maintaining cartilage integrity and its implications in degenerative diseases, recombinant COL9A1 protein has emerged as a valuable tool for studying its biochemical properties and functional roles in cartilage pathology. This recombinant protein can be utilized to investigate its interactions with other ECM components, assess its role in chondrocyte behavior, and explore potential therapeutic applications in cartilage repair and regeneration. Furthermore, understanding the molecular mechanisms involving COL9A1 may lead to novel strategies for treating cartilage degeneration and enhancing joint health, highlighting the significance of COL9A1 in both basic research and clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US