Analytical Data
-
Gene name
HPCAL1
- Application
-
Alternative Names
HPCAL1;BDR1;Hippocalcin-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37235
-
Expression Region
1-193aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEW YKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTI DFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYK MVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV RLLQCDPSSASQF
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HPCAL1, or High-Performance Calcium Binding Protein 1, is a calcium-binding protein that plays a crucial role in various cellular processes, including signal transduction, neurotransmitter release, and cytoskeletal dynamics. The study of HPCAL1 has garnered significant interest due to its involvement in neurological functions and potential implications in neurodegenerative diseases. As a member of the calmodulin family, HPCAL1 interacts with various target proteins in a calcium-dependent manner, influencing cellular signaling pathways. Research on HPCAL1 has focused on its structural characteristics, calcium-binding properties, and its effects on neuronal excitability and plasticity. Understanding the molecular mechanisms by which HPCAL1 operates can provide insights into the pathophysiology of conditions like Alzheimer's disease and other synaptopathies. The recombinant production of HPCAL1 has allowed for detailed biochemical and biophysical studies, enabling researchers to explore its functional roles in greater depth. Additionally, the therapeutic potential of HPCAL1 modulation in treating calcium dysregulation-related disorders is an exciting area of investigation. Overall, HPCAL1 serves as an important model for studying calcium signaling and its broader implications in health and disease.











