Analytical Data
-
Gene name
IGLV3-25
- Application
-
Alternative Names
IGLV3-25; Immunoglobulin lambda variable 3-25; Ig lambda chain V-IV region Hil
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01717
-
Expression Region
1-233aa
-
AA Sequence
MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSPGQTARITCSADALPKQYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADTSGTYVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
-
Molecular Weight
51.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGLV3-25, a member of the immunoglobulin lambda light chain gene family, has garnered attention in the field of immunology due to its role in the immune response and antibody diversity. The study of IGLV3-25 recombinant proteins is particularly relevant in understanding the mechanisms of B cell maturation and the processes leading to the production of antibodies that can effectively recognize and neutralize various pathogens. Recent advancements in biotechnology have enabled the recombinant expression of IGLV3-25 proteins, facilitating their use in various applications, including vaccine development, antibody engineering, and therapeutic interventions. Research indicates that specific mutations in the IGLV3-25 gene may enhance affinity and specificity towards certain antigens, making it a valuable target for engineering high-affinity antibodies. Furthermore, the insights gained from the structural characterization of IGLV3-25 can help decipher the intricate interactions between antibodies and their corresponding antigens. Overall, studies focused on IGLV3-25 recombinant proteins hold promise for innovative approaches in treating infectious diseases and improving vaccine efficacy.
