Analytical Data
-
Gene name
APOLD1
- Application
-
Alternative Names
APOLD1；VERGE；ApolipoProtein L domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LR9
-
Expression Region
1-279aa
-
AA Sequence
MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOLD1, or atypical protein containing a pleckstrin homology domain, is a member of the APOLD protein family that plays a critical role in various biological processes, particularly in the regulation of vascular permeability and inflammation. Research has shown that APOLD1 is highly expressed in endothelial cells, which line blood vessels, suggesting its potential involvement in maintaining vascular integrity and responding to injury. Recent studies have indicated that APOLD1 may influence the immune response and modulate the signaling pathways related to cell adhesion and migration. Given its significance in mediating endothelial function, there is growing interest in developing recombinant APOLD1 proteins for functional studies to better understand its role in health and disease. Such research could pave the way for novel therapeutic approaches aimed at treating vascular-related disorders, including atherosclerosis and other inflammatory conditions. Through the expression and characterization of recombinant APOLD1, scientists hope to elucidate its molecular mechanisms and interactions, potentially revealing new targets for drug development in cardiovascular medicine.
