Analytical Data
-
Gene name
IGLV3-21
- Application
-
Alternative Names
IGLV3-21; Immunoglobulin lambda variable 3-21; Ig lambda chain V-III region LOI; Ig lambda chain V-V region DEL; Ig lambda chain V-VII region MOT
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80748
-
Expression Region
1-233aa
-
AA Sequence
MAWTVLLLGLLSHCTVSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVMVVYDDSDRPSGIPERLSGSNSGNTATLTISRVEAGDEADYYCQVWDSTSNHYVFGTGTKVSVLSQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The IGLV3-21 gene encodes a specific type of immunoglobulin light chain, which plays a crucial role in the immune response by forming part of antibodies that recognize and neutralize pathogens. Research into IGLV3-21 recombinant proteins is driven by the need to better understand how variations in immunoglobulin light chains influence antibody diversity and specificity. This gene has garnered attention due to its potential involvement in various autoimmune diseases and its role in the body's ability to respond to infections and malignancies. By studying IGLV3-21 recombinant proteins, scientists aim to dissect the molecular mechanisms underlying antibody production and affinity maturation, as well as to explore their therapeutic applications in designing antibodies for vaccine development and targeted therapies. Additionally, characterizing the structural and functional properties of the IGLV3-21 protein can lead to insights into its contributions to immune regulation and potential implications in personalized medicine. Overall, the investigation of IGLV3-21 recombinant proteins represents a significant avenue of research in the field of immunology, with the promise of advancing our understanding of immune system functions and improving treatment strategies for immune-related conditions.
