Analytical Data
-
Gene name
PLB
- Application
-
Alternative Names
PLB；PLB；Phospholipase B1. membrane-associated
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26678
-
Expression Region
1-52aa
-
AA Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
-
Molecular Weight
33.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PLB (phospholamban) recombinant proteins has garnered significant attention in the field of cardiac physiology and molecular biology due to their crucial role in regulating cardiac muscle function. PLB is a small transmembrane protein that is predominantly expressed in cardiac myocytes, where it modulates the activity of the sarcoplasmic reticulum Ca²⁺-ATPase (SERCA), thereby influencing intracellular calcium levels and cardiac contraction. Dysfunctional PLB activity is linked to various cardiac diseases, including heart failure and cardiomyopathy. Recombinant PLB allows researchers to investigate its structure-function relationships, the effects of post-translational modifications, and the interactions with other proteins. Producing PLB in a recombinant form enables detailed studies of its biophysical properties and cellular mechanisms, facilitating the exploration of therapeutic targets for cardiac disorders. Moreover, advancements in recombinant DNA technology and protein expression systems have improved the yield and functionality of PLB, paving the way for novel strategies in drug development and gene therapy aimed at restoring proper heart function. Understanding PLB dynamics and its regulatory mechanisms holds potential for innovative approaches to treat cardiac diseases, making it a focal point for ongoing research in cardiovascular health.
