Analytical Data
-
Gene name
IGHG3
- Application
-
Alternative Names
IGHG3Immunoglobulin heavy constant gamma 3; HDC; Heavy chain disease protein; Ig gamma-3 chain C region
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01860
-
Expression Region
1-521aa
-
AA Sequence
MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSDHYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSVHLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
-
Molecular Weight
83.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant human immunoglobulin G3 (IgG3) is a subtype of immunoglobulin that plays a crucial role in the immune response, particularly in its ability to opsonize pathogens and activate complement systems. The study of IgG3 has gained significant attention due to its unique structural properties, which differentiate it from other IgG subclasses. Notably, IgG3 has a longer hinge region, allowing for increased flexibility and enhanced interaction with antigens and immune effectors. This characteristic makes IgG3 particularly effective in neutralizing viruses and targeting tumor cells. Research has focused on the production and characterization of recombinant IgG3 to understand its functional properties and therapeutic potential. Various expression systems, including mammalian cell lines, yeast, and bacteria, have been employed to generate recombinant IgG3 for both research and clinical applications. Additionally, advancements in biotechnological methods have enabled the optimization of glycosylation patterns and antibody engineering to enhance the efficacy and stability of recombinant IgG3. With the ongoing exploration of its mechanisms and applications, recombinant IgG3 presents promising opportunities for the development of novel therapeutic agents, particularly in the fields of cancer immunotherapy and infectious diseases.
