Analytical Data
-
Gene name
PPARd
- Application
-
Alternative Names
PPARd；NR1C2；PPARB；Peroxisome proliferator-activated receptor delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03181
-
Expression Region
165-441aa
-
AA Sequence
GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Peroxisome proliferator-activated receptors (PPARs) are a family of nuclear receptor proteins that function as transcription factors regulating various biological processes, including lipid metabolism, glucose homeostasis, and inflammation. Among them, PPAR delta (PPARd) has garnered significant attention due to its role in fatty acid oxidation and energy homeostasis. Research has shown that PPARd activation can enhance metabolic flexibility, making it a potential therapeutic target for metabolic disorders such as obesity, diabetes, and cardiovascular diseases. The recombinant protein of PPARd is critical for understanding its structure-function relationships and for elucidating the molecular mechanisms through which it exerts its effects on gene expression. By producing and studying the PPARd recombinant protein, scientists aim to unravel its interactions with specific co-regulators and ligands, paving the way for the development of targeted drugs. Recent advancements in recombinant DNA technology have enabled the efficient production of PPARd in various expression systems, facilitating in vitro and in vivo studies. Such research is essential not only for basic science but also for translating findings into clinical applications, potentially offering new strategies for managing metabolic syndromes.
