Cat: PA2000-4289

Recombinant Human PHLPVI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PHLPVI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PHLPVI;Pollen allergen Phl p 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43215

  • Expression Region

    1-132aa

  • AA Sequence

    MVAMFLAVAVVLGLATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA

  • Molecular Weight

    13.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PHLPVI (PH domain and Leucine-rich repeat Protein 1 Variant I) recombinant protein emerges from the growing interest in understanding the biological roles and mechanisms of proteins that contain PH domains and leucine-rich repeats. PHLPVI has gained attention due to its potential involvement in cellular signaling pathways and disease processes, including cancer and neurodegenerative disorders. Previous research suggests that proteins with similar structural motifs play critical roles in mediating protein-protein interactions and cellular localization, which are vital for maintaining cellular homeostasis. The recombinant expression of PHLPVI enables researchers to produce substantial quantities of the protein for functional studies and characterization. Utilizing techniques such as molecular cloning, expression in suitable host systems, and purification methods, scientists can investigate the biochemical properties, structural characteristics, and biological activities of PHLPVI. Understanding the functional implications of PHLPVI at the molecular level may provide insights into its role in health and disease, paving the way for potential therapeutic applications. As the field continues to evolve, ongoing studies focus on elucidating the specific interactions and pathways mediated by PHLPVI, thereby contributing to a deeper understanding of its significance in various physiological and pathological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US