Analytical Data
-
Gene name
GUCY1A2
- Application
-
Alternative Names
GUCY1A2；GUC1A2；GUCSA2；Guanylate cyclase soluble subunit alpha-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33402
-
Expression Region
500-732aa
-
AA Sequence
GDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL
-
Molecular Weight
27.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCY1A2 encodes the alpha subunit of soluble guanylate cyclase (sGC), an important enzyme involved in the nitric oxide signaling pathway, which plays a crucial role in various physiological processes, including vasodilation, neurotransmission, and cellular signaling. Mutations in the GUCY1A2 gene have been linked to various cardiovascular and neurological disorders, highlighting its significance in human health. The study of GUCY1A2 recombinant proteins is essential for understanding its structure-function relationship and elucidating the molecular mechanisms underlying its role in cellular signaling. By producing and characterizing recombinant GUCY1A2 proteins, researchers aim to explore their biochemical properties, interactions with nitric oxide, and potential regulatory mechanisms. Such studies may provide valuable insights into therapeutic targets for diseases associated with sGC dysfunction, including hypertension and heart failure. Additionally, recombinant GUCY1A2 proteins can serve as important tools for drug discovery and development, as they allow for the screening of small molecules that can modulate sGC activity. Overall, the investigation of GUCY1A2 recombinant proteins is a promising area of research that holds potential for advancing our understanding of cardiovascular biology and developing novel therapeutic strategies.
