Analytical Data
-
Gene name
IGHA2
- Application
-
Alternative Names
IGHA2Immunoglobulin heavy constant alpha 2; Ig alpha-2 chain C region; Ig alpha-2 chain C region BUT; Ig alpha-2 chain C region LAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01877
-
Expression Region
1-477aa
-
AA Sequence
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
-
Molecular Weight
78 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGHA2, a member of the immunoglobulin superfamily, encodes the immunoglobulin A (IgA) chain, playing a critical role in the immune response, particularly in mucosal immunity. IgA, a dimeric form found predominantly in mucosal secretions, such as saliva, tears, and gastrointestinal secretions, acts as a first line of defense against pathogens. Understanding the structure and function of IGHA2 and its encoded protein is essential for insights into immunological processes and the development of various diseases, including autoimmune disorders and infections. Recent advancements in recombinant protein technology have facilitated the production of IGHA2, allowing for detailed studies of its properties and interactions. Research into IGHA2 recombinant proteins aims to elucidate their biological functions, roles in immune regulation, and potential therapeutic applications. Furthermore, understanding variations in IGHA2 expression and secretion is vital, as anomalies can lead to deficiencies in mucosal immunity or contribute to pathological conditions. Overall, IGHA2 recombinant protein research holds promise for improving vaccine design, developing immunotherapies, and enhancing our understanding of immune system dynamics.
