Analytical Data
-
Gene name
HTR1D
- Application
-
Alternative Names
HTR1D;HTR1DA;HTRL;5-hydroxytryptamine receptor 1D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28221
-
Expression Region
1-38aa
-
AA Sequence
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HTR1D, a member of the serotonin receptor family, plays a crucial role in various physiological processes, including mood regulation, cognition, and neuroplasticity. This G-protein-coupled receptor is primarily implicated in the modulation of serotonin signaling, which is essential for maintaining mental health. Dysregulation of serotonin receptors, including HTR1D, has been linked to several psychiatric disorders such as depression, anxiety, and schizophrenia. Research into the structure and function of HTR1D is vital for understanding its role in these conditions and for the development of targeted pharmacological interventions. Recombinant protein expression of HTR1D allows for detailed studies of its signaling pathways, ligand-binding properties, and potential as a therapeutic target. By employing techniques such as molecular cloning and protein purification, researchers can create HTR1D proteins for in vitro studies, enabling a closer examination of its interactions with ligands and downstream signaling mechanisms. This research holds promise for uncovering new approaches to treat serotonin-related disorders, highlighting the significance of HTR1D in neuroscience and pharmacology.











