Cat: PA2000-4287

Recombinant Human HTR1D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HTR1D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HTR1D;HTR1DA;HTRL;5-hydroxytryptamine receptor 1D

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28221

  • Expression Region

    1-38aa

  • AA Sequence

    MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

  • Molecular Weight

    19.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HTR1D, a member of the serotonin receptor family, plays a crucial role in various physiological processes, including mood regulation, cognition, and neuroplasticity. This G-protein-coupled receptor is primarily implicated in the modulation of serotonin signaling, which is essential for maintaining mental health. Dysregulation of serotonin receptors, including HTR1D, has been linked to several psychiatric disorders such as depression, anxiety, and schizophrenia. Research into the structure and function of HTR1D is vital for understanding its role in these conditions and for the development of targeted pharmacological interventions. Recombinant protein expression of HTR1D allows for detailed studies of its signaling pathways, ligand-binding properties, and potential as a therapeutic target. By employing techniques such as molecular cloning and protein purification, researchers can create HTR1D proteins for in vitro studies, enabling a closer examination of its interactions with ligands and downstream signaling mechanisms. This research holds promise for uncovering new approaches to treat serotonin-related disorders, highlighting the significance of HTR1D in neuroscience and pharmacology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US