Analytical Data
-
Gene name
HLA-DRA
- Application
-
Alternative Names
HLA-DRA;HLA-DRA1;HLA class II histocompatibility antigen. DR alpha chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01903
-
Expression Region
26-254aa
-
AA Sequence
GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS&IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DRA, a key component of the major histocompatibility complex (MHC) class II molecules, plays a crucial role in the immune response by presenting antigens to CD4+ T cells. Its proper functioning is essential for the activation of immune responses against pathogens and is also involved in the development of autoimmune diseases and transplant rejection. The study of HLA-DRA recombinant proteins has gained significant attention due to their potential applications in therapeutic immunology and vaccine development. Researchers aim to better understand the structure and function of HLA-DRA in various contexts, including its interactions with different peptides and T cell receptors, and its expression patterns in various diseases. Advances in recombinant DNA technology have facilitated the generation of HLA-DRA proteins, enabling detailed studies of their biochemical properties and immunological functions. This research is pivotal not only for understanding basic immune mechanisms but also for developing strategies to manipulate immune responses in clinical settings, such as enhancing vaccine efficacy or improving transplant outcomes. The ongoing investigation into HLA-DRA recombinant proteins is expected to provide valuable insights into immune system regulation and the development of novel immunotherapeutic approaches.











