Analytical Data
-
Gene name
LOX1
- Application
-
Alternative Names
LOX1；LOG15；Polyunsaturated fatty acid lipoxygenase ALOX15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78380
-
Expression Region
61-273aa
-
AA Sequence
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLA RKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSS GSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAA FSICQKKANLRAQVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOX1, or lectin-like oxidized low-density lipoprotein receptor 1, is a crucial protein involved in lipid metabolism and atherosclerosis. As a pattern recognition receptor, LOX1 binds to oxidized low-density lipoproteins (oxLDL), initiating a cascade of cellular events that contribute to the pathogenesis of cardiovascular diseases. The receptor is predominantly expressed in endothelial cells, macrophages, and smooth muscle cells, where it plays a significant role in the development of foam cells and vascular inflammation. The study of recombinant LOX1 proteins has garnered significant attention due to their potential utility in understanding the receptor's structure-function relationship and in the development of therapeutic strategies targeting cardiovascular diseases. By engineering LOX1 proteins, researchers aim to elucidate the molecular mechanisms underlying its interactions with oxLDL and to investigate its role in inflammation and cellular signaling pathways. Moreover, recombinant LOX1 proteins serve as valuable tools for drug discovery, enabling the identification of small molecules or antibodies that can modulate its activity. The exploration of LOX1 as a biomarker for atherosclerosis and cardiovascular risk further emphasizes the importance of this receptor in clinical research. Overall, the investigation of LOX1 recombinant proteins is expected to provide critical insights into the mechanisms of cardiovascular diseases and to pave the way for novel therapeutic approaches aimed at reducing the burden of atherosclerosis and its associated complications.
