Cat: PA2000-190DB

Recombinant Human CK17 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CK17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CK17;BCA3;C11orf17;;A-kinase-interacting Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q04695

  • Expression Region

    1-432aa

  • AA Sequence

    MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGS TLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD KVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATV DNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLA RADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLS RIPNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKK EPVTTRQVRTIVEEVQDGKVISSREQVHQTTR

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CK17, also known as Cytokeratin 17, is a member of the keratin family of proteins, which play a crucial role in the structural integrity and function of epithelial cells. Research into CK17 has gained momentum due to its significant involvement in various biological processes, including cell proliferation, differentiation, and the response to injury and inflammation. Notably, CK17 is upregulated in several pathological conditions, such as psoriasis, lichen planus, and certain types of carcinomas, making it a valuable biomarker for disease diagnosis and prognosis. Additionally, CK17 is implicated in the regulation of epithelial-mesenchymal transition (EMT), a critical process in cancer metastasis. The study of recombinant CK17 proteins has provided insights into their functional roles and interactions within the cellular environment. Advancements in recombinant DNA technology have facilitated the production of CK17 in vitro, allowing researchers to investigate its properties and potential therapeutic applications. By understanding the molecular mechanisms underlying CK17 expression and regulation, scientists aim to develop targeted therapies that could mitigate the effects of diseases associated with altered CK17 levels. Overall, the study of CK17 recombinant proteins not only enhances the understanding of epithelial biology but also opens avenues for developing clinical tools for early diagnosis and innovative treatments for epithelial-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US