Analytical Data
-
Gene name
ICF45
- Application
-
Alternative Names
THG1L; ICF45; Probable tRNA(His) guanylyltransferase; EC 2.7.7.79; Interphase cytoplasmic foci protein 45; tRNA-histidine guanylyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NWX6
-
Expression Region
1-269aa
-
AA Sequence
MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
-
Molecular Weight
55.33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ICF45, a recombinant protein derived from the Inducible Costimulator (ICOS) pathway, has garnered significant attention in immunology research due to its potential role in modulating immune responses. This pathway is crucial for T-cell activation and proliferation, playing a vital role in the regulation of adaptive immunity. The understanding of ICF45's function has implications for various diseases, including autoimmune disorders, cancers, and infectious diseases. Recent studies suggest that manipulating the ICOS pathway through the use of ICF45 may enhance T-cell responses in cancer immunotherapy or help mitigate excessive immune reactions in autoimmune conditions. To further explore these possibilities, researchers have focused on characterizing the biochemical properties of ICF45, including its interactions with immune cells and its signaling mechanisms. Investigations into the therapeutic applications of ICF45 could lead to novel strategies for enhancing vaccine efficacy or developing personalized treatment approaches in immune-related diseases. With the continuous advancements in recombinant protein technologies, the potential of ICF45 as a therapeutic agent represents a promising frontier in the field of immunotherapy and beyond. Thus, understanding the biology and clinical significance of ICF45 may pave the way for innovative treatments that harness the body's immune system more effectively.
