Analytical Data
-
Gene name
ICEBERG
- Application
-
Alternative Names
CARD18; ICEBERG; UNQ5804/PRO19611Caspase recruitment domain-containing protein 18; Caspase-1 inhibitor Iceberg
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57730
-
Expression Region
1-90aa
-
AA Sequence
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ICEBERG (Inhibition of CellExpansion by Binding of Enhanced Repressive Group) protein has emerged as a significant focus of research in the field of plant biology and stress responses. Identified in various plant species, ICEBERG plays a crucial role in regulating plant growth and development, particularly under stress conditions such as drought and salinity. As plants face various environmental challenges, the ability to regulate water loss and maintain cellular integrity becomes essential for survival. Research has shown that ICEBERG acts as a negative regulator in signaling pathways associated with stress responses, effectively modulating the expression of target genes that influence plant adaptation mechanisms. The exploration of ICEBERG not only deepens our understanding of the molecular pathways involved in plant resilience but also opens avenues for potential agricultural applications. Engineering crops to enhance ICEBERG’s function could lead to improved stress tolerance, thereby contributing to food security in the face of climate change. This research underscores the importance of understanding plant response mechanisms at the molecular level, aiming to develop strategies for crop improvement and sustainable agriculture practices.











