Analytical Data
-
Gene name
espK
- Application
-
Alternative Names
espK；ESX-1 secretion-associated Protein EspK
-
Species
Mycobacterium tuberculosis
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WJC1
-
Expression Region
21-114aa
-
AA Sequence
VEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVD
-
Molecular Weight
17.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on espK recombinant protein has gained significant attention due to its potential role in understanding bacterial pathogenesis, particularly in relation to Enteropathogenic Escherichia coli (EPEC). EPEC is a major cause of diarrhea in infants and young children, leading to severe morbidity and mortality in developing countries. The espK gene is part of a locus of enterocyte effacement (LEE) pathogenicity island, which is essential for the attachment and colonization of EPEC in the intestinal epithelium. EspK is believed to play a crucial role in the modulation of host immune responses and bacterial adherence, making it a critical factor in the virulence of EPEC. By studying espK and producing its recombinant protein, researchers aim to elucidate its functional mechanisms and interactions with host cells. This knowledge could pave the way for new therapeutic strategies or vaccine development against EPEC infections. Furthermore, insights gained from espK studies may contribute to a broader understanding of how similar proteins in other pathogenic bacteria contribute to disease, enhancing our capacity to combat bacterial infections globally. Overall, the exploration of espK as a target for intervention in EPEC-related diseases emphasizes the necessity of continued investigation into bacterial virulence factors and their implications for public health.
