Cat: PA2000-4252

Recombinant Human SLC1A3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC1A3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC1A3;EAAT1;GLAST;GLAST1;Excitatory amino acid transporter 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43003

  • Expression Region

    146-236aa

  • AA Sequence

    HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG

  • Molecular Weight

    11.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC1A3, also known as GLT-1 (Glutamate Transporter 1), is a crucial membrane protein responsible for the uptake of the neurotransmitter glutamate in the central nervous system. It plays a vital role in maintaining synaptic glutamate homeostasis, preventing excitotoxicity, and regulating neuronal communication. Dysregulation of SLC1A3 has been implicated in various neurological disorders, including epilepsy, amyotrophic lateral sclerosis (ALS), and schizophrenia. Due to its significant role in neurotransmission and potential therapeutic implications, the study of SLC1A3 has gained considerable attention. Historically, understanding the structure and function of this protein has been hindered by challenges in obtaining sufficient quantities of properly folded and functional protein. The production of recombinant SLC1A3 in heterologous systems has emerged as a valuable strategy. By utilizing techniques in molecular biology and protein engineering, researchers can generate and purify recombinant SLC1A3, enabling detailed biophysical characterization, structural studies, and functional assays. These efforts contribute to a deeper understanding of SLC1A3’s transport mechanisms, its interactions with other cellular components, and its role in health and disease, paving the way for potential drug discovery and novel therapeutic approaches targeting glutamate-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US