Analytical Data
-
Gene name
SLC1A3
- Application
-
Alternative Names
SLC1A3；EAAT1；GLAST；GLAST1；Excitatory amino acid transporter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43003
-
Expression Region
146-236aa
-
AA Sequence
HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
-
Molecular Weight
11.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC1A3, also known as GLT-1 (Glutamate Transporter 1), is a crucial membrane protein responsible for the uptake of the neurotransmitter glutamate in the central nervous system. It plays a vital role in maintaining synaptic glutamate homeostasis, preventing excitotoxicity, and regulating neuronal communication. Dysregulation of SLC1A3 has been implicated in various neurological disorders, including epilepsy, amyotrophic lateral sclerosis (ALS), and schizophrenia. Due to its significant role in neurotransmission and potential therapeutic implications, the study of SLC1A3 has gained considerable attention. Historically, understanding the structure and function of this protein has been hindered by challenges in obtaining sufficient quantities of properly folded and functional protein. The production of recombinant SLC1A3 in heterologous systems has emerged as a valuable strategy. By utilizing techniques in molecular biology and protein engineering, researchers can generate and purify recombinant SLC1A3, enabling detailed biophysical characterization, structural studies, and functional assays. These efforts contribute to a deeper understanding of SLC1A3’s transport mechanisms, its interactions with other cellular components, and its role in health and disease, paving the way for potential drug discovery and novel therapeutic approaches targeting glutamate-related pathologies.
