Analytical Data
-
Gene name
SLC25A20
- Application
-
Alternative Names
SLC25A20；CAC；CACT；；Mitochondrial carnitine/acylcarnitine carrier Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43772
-
Expression Region
1-301aa
-
AA Sequence
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
-
Molecular Weight
59.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A20, also known as the mitochondrial carrier protein, plays a critical role in cellular metabolism by facilitating the transport of acylcarnitines across the mitochondrial membrane. Its dysfunction has been implicated in various metabolic disorders, particularly in the context of mitochondrial fatty acid oxidation. The study of SLC25A20 recombinant protein is crucial for understanding its structural and functional properties, which may shed light on the mechanisms underlying related pathologies. Research indicates that mutations in the SLC25A20 gene can lead to severe clinical manifestations, including neonatal-onset metabolic crises, cardiomyopathy, and neurological deficits. Moreover, insights into the protein’s transport mechanisms can contribute to the development of therapeutic strategies targeting mitochondrial dysfunctions. By producing recombinant SLC25A20 in an experimental setting, scientists aim to elucidate its transport kinetics, substrate specificity, and the effects of various inhibitors. This research is fundamental for comprehensively understanding the physiological role of SLC25A20 and its potential as a target for pharmacological interventions in metabolic diseases.
