Analytical Data
-
Gene name
HTR3B
- Application
-
Alternative Names
HTR3B; 5-hydroxytryptamine receptor 3B; 5-HT3-B; 5-HT3B; Serotonin receptor 3B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95264
-
Expression Region
1-441aa
-
AA Sequence
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HTR3B protein, a member of the 5-hydroxytryptamine (serotonin) receptor family, plays a crucial role in the central nervous system by mediating neurotransmission and influencing various physiological processes. Research on HTR3B is particularly relevant due to its involvement in multiple psychiatric disorders and conditions such as anxiety, depression, and irritable bowel syndrome. The receptor is known for its role in fast synaptic transmission and is a target for various pharmacological agents, including antiemetics and anxiolytics. Moreover, genetic studies have identified polymorphisms in the HTR3B gene that may contribute to individual susceptibility to these illnesses, making it a significant focus in the field of neurobiology and pharmacogenetics. The production of recombinant HTR3B proteins is essential for studying their structural and functional properties, including their interaction with ligands and other proteins. As a result, the development of effective expression systems and purification methods for HTR3B is vital for elucidating its mechanisms and therapeutic potential. By advancing our understanding of HTR3B, researchers aim to identify novel targets for drug development, ultimately contributing to more effective treatments for serotonin-related disorders.
