Analytical Data
-
Gene name
HTR5A
- Application
-
Alternative Names
HTR5A; 5-hydroxytryptamine receptor 5A; 5-HT-5; 5-HT-5A; 5-HT5A; Serotonin receptor 5A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47898
-
Expression Region
1-357aa
-
AA Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
-
Molecular Weight
40.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HTR5A, or 5-Hydroxytryptamine Receptor 5A, is a member of the serotonin receptor family, which plays a pivotal role in various neurological processes, including mood regulation, cognition, and perception. Research into HTR5A has gained traction due to its potential implications in psychiatric disorders, such as depression and schizophrenia, as well as in neurodegenerative diseases. The interest in HTR5A is further heightened by its unique expression patterns in the brain and its interaction with other neurotransmitter systems, suggesting it could serve as a valuable therapeutic target. However, the limited availability of pure, functional HTR5A protein has posed challenges in studying its structure, signaling mechanisms, and pharmacological properties. The recombinant production of HTR5A allows for detailed investigations into its biology, enabling researchers to explore its role in cellular signaling pathways and interactions with various ligands. This facilitates the development of novel pharmacological agents aimed at modulating HTR5A activity, potentially leading to innovative treatment strategies for related mental health disorders. Understanding the structure-function relationship of HTR5A through recombinant technology not only enriches our knowledge of serotonin receptor biology but may also pave the way for breakthroughs in therapeutic interventions targeting this receptor.
