Analytical Data
-
Gene name
HSDL2
- Application
-
Alternative Names
C9orf99; FLJ25855; hsdl2; HSDL2_HUMAN; Hydroxysteroid dehydrogenase like protein 2; Hydroxysteroid dehydrogenase-like protein 2; MGC10940; MS728; SDR13C1; Short chain dehydrogenase/reductase family 13C. member 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6YN16
-
Expression Region
1-418aa
-
AA Sequence
MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL
-
Molecular Weight
71.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSDL2, or Human Serine Dehydratase-Like 2, is a member of the serine-dehydratase family and plays a crucial role in the metabolism of amino acids. Its emerging significance in physiological and pathological processes has spurred research interest, particularly due to its implication in various diseases, including cancer and metabolic disorders. Understanding the biochemical pathways associated with HSDL2 is essential for deciphering its function and contribution to cellular homeostasis and disease progression. Previous studies have indicated that HSDL2 may be involved in the regulation of serine levels, which is crucial for numerous biological processes, including protein synthesis and energy metabolism. The recombinant expression of HSDL2 allows for detailed functional studies, providing insights into its enzymatic activity, substrate specificity, and potential regulatory mechanisms. By producing and characterizing HSDL2 as a recombinant protein, researchers can investigate its role in metabolic pathways, explore potential therapeutic targets, and contribute to the understanding of its involvement in disease pathology. Additionally, the development of HSDL2 inhibitors or modulators could lead to novel therapeutic strategies for conditions associated with its dysregulation. Overall, the study of HSDL2 as a recombinant protein is a vital step towards elucidating its biological significance and therapeutic potential.
