Analytical Data
-
Gene name
HSD17B6
- Application
-
Alternative Names
17-beta-HSD 6; 17-beta-HSD6; 17-beta-hydroxysteroid dehydrogenase type 6; 3 hydroxysteroid epimerase ; 3(alpha >beta) hydroxysteroid epimerase ; 3(alpha >beta) hydroxysteroid epimerasel; 3-alpha->.beta-HSE; 3-alpha->.beta-hydroxysteroid epimerase; H17B6_HUMAN; HSD17B6; HSE ; Hydroxysteroid (17 beta) dehydrogenase 6; Hydroxysteroid (17 beta) dehydrogenase 6 homolog (mouse); Hydroxysteroid 17 beta dehydrogenase 6; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase 3 hydroxysteroid epimerase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14756
-
Expression Region
1-317aa
-
AA Sequence
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
-
Molecular Weight
60.61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSD17B6 (17β-Hydroxysteroid Dehydrogenase type 6) is an important enzyme involved in steroid metabolism, specifically in the conversion of androstenedione to testosterone and estrone to estradiol. Understanding the function and regulation of HSD17B6 is crucial for elucidating the mechanisms of steroid hormone action and their implications in various physiological and pathological conditions, including reproductive health, metabolic syndrome, and hormone-related cancers. The enzyme's role in modulating local steroid concentrations can significantly influence tissue responses to hormones, thereby affecting growth, differentiation, and apoptosis in target cells. Furthermore, interest in HSD17B6 is heightened due to its potential as a therapeutic target; modulation of its activity could lead to novel treatments for conditions such as breast cancer, where hormone regulation plays a central role. Research on recombinant HSD17B6 protein has enabled detailed biochemical studies, including enzyme kinetics, substrate specificity, and inhibitor profiling. The production of this recombinant protein allows for high-throughput screening of compounds that could enhance or inhibit its activity, paving the way for the development of new therapeutic agents. Furthermore, structural studies of HSD17B6 could provide insights into the molecular mechanisms underlying its enzymatic functions. By advancing our knowledge of HSD17B6, researchers aim to uncover its broader implications in human health and disease, ultimately contributing to more effective strategies for managing hormone-related disorders.
