Cat: PA1000-1390

Recombinant Human HADHB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HADHB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HADHB;Trifunctional enzyme subunit beta. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55084

  • Expression Region

    34-474aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSH MGSAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLA RAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTP AHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMR KLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRL AAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNG IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMG YKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHE AFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPF GATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HADHB (hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta) is a crucial enzyme involved in the mitochondrial fatty acid oxidation pathway, specifically in the catabolism of long-chain fatty acids. Mutations in the HADHB gene lead to a rare but severe metabolic disorder known as mitochondrial trifunctional protein deficiency, characterized by hypoketotic hypoglycemia, muscle weakness, and increased accumulation of toxic fatty acid metabolites. The significance of HADHB extends beyond basic biochemistry; it has implications for understanding metabolic syndromes and developing potential therapeutic strategies. Researchers aim to elucidate the structural and functional characteristics of HADHB through recombinant protein techniques, which involve producing the protein in a host system, often Escherichia coli or yeast. Understanding the enzyme's activity, kinetics, and interactions with other metabolic pathways can provide insights into its role in cellular energy homeostasis and potential links to more common conditions such as obesity and type 2 diabetes. Moreover, recombinant HADHB may serve as a valuable tool for drug discovery and the assessment of therapeutic compounds aimed at correcting the enzyme's deficiencies. As such, studies of HADHB recombinant protein are integral not only to the basic understanding of mitochondrial function and energy metabolism but also to the broader landscape of metabolic disease research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US