Analytical Data
-
Gene name
HRK
- Application
-
Alternative Names
HRK; BID3; Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00198
-
Expression Region
1-91aa
-
AA Sequence
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
-
Molecular Weight
36.41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HRK (Harakiri) is a member of the Bcl-2 family of proteins that plays a crucial role in the regulation of apoptosis, the process of programmed cell death. The study of HRK is particularly significant due to its dual function as both a pro-apoptotic and anti-apoptotic factor, depending on the cellular context. Understanding the structure and function of HRK is vital for unraveling the complex mechanisms underlying cell survival and death, which have implications in various diseases, including cancer, neurodegenerative disorders, and autoimmune diseases. Researchers are particularly interested in HRK's interactions with other proteins in the Bcl-2 family, as well as its regulation by post-translational modifications. The recombinant expression of HRK protein allows for detailed biochemical and structural studies, enabling scientists to elucidate its role in apoptotic pathways and its potential as a therapeutic target. By investigating the specific mechanisms through which HRK influences cellular fate, researchers hope to provide insights that could lead to the development of novel treatment strategies aimed at modulating apoptosis in disease contexts.
