Analytical Data
-
Gene name
HRB
- Application
-
Alternative Names
AGFG1; AGFG1_HUMAN; Arf-GAP domain and FG repeats-containing protein 1; ArfGAP with FG repeats 1; AU045498; C130049H11Rik; C85612; D730048C23Rik; DKFZp686I15205; HIV 1 Rev binding protein; HIV-1 Rev-binding protein; HRB; MGC116375
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52594
-
Expression Region
1-562aa
-
AA Sequence
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
-
Molecular Weight
84.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on HRB (Heterogeneous Nuclear Ribonucleoprotein R) recombinant proteins has gained significant attention due to their critical role in RNA metabolism and regulation of gene expression. HRB proteins are essential components of the ribonucleoprotein complexes and are involved in processes such as mRNA splicing, transport, and translation. Aberrations in HRB function have been linked to various diseases, including cancer and neurodegenerative disorders, making them a focal point for therapeutic exploration. Furthermore, the ability to produce HRB recombinant proteins has enabled the detailed study of their structural and functional properties, offering insights into their mechanisms of action. Advances in protein engineering and expression systems allow researchers to create functional HRB variants that can be utilized in both basic biology and applied biomedical research. This burgeoning field aims to unravel the complex interactions of HRB proteins within the cellular environment, paving the way for potential diagnostic and therapeutic applications in human health.
