Analytical Data
-
Gene name
HOXD10
- Application
-
Alternative Names
AI385591; AI874987; Homeo box 4D; Homeo box D10 ; Homeobox D10; Homeobox protein Hox-4D; Homeobox protein Hox-4E; Homeobox protein Hox-D10; Hox 4.4; Hox 4.5; Hox 4D ; Hox 4E ; Hox 5.3; HOX4D ; HOX4E; HOXD10; HXD10; HXD10_HUMAN; OTTMUSP00000017845; RP23-313J15.9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28358
-
Expression Region
1-340aa
-
AA Sequence
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
-
Molecular Weight
64.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXD10, a member of the Homeobox gene family, plays a crucial role in developmental processes, particularly in the regulation of limb and organ morphogenesis. Its expression is tightly regulated during embryogenesis, and alterations in HOXD10 expression have been linked to various developmental disorders and diseases, such as limb malformations and certain cancers. The study of HOXD10 recombinant protein is essential for understanding its functional mechanisms at the molecular level. By producing and purifying recombinant HOXD10 protein, researchers aim to investigate its interactions with other cellular proteins, elucidate its role in gene regulation, and analyze its impact on signaling pathways involved in development. Additionally, assessing the biochemical properties of HOXD10 can provide insights into its potential as a therapeutic target. The insights gained from HOXD10 recombinant protein studies could pave the way for developing novel interventions in genetic disorders and malignancies where HOXD10 expression is disrupted. Understanding the structure-function relationship of HOXD10 could also contribute to broader research in developmental biology, regenerative medicine, and cancer therapeutics.
