Analytical Data
-
Gene name
GSTM2
- Application
-
Alternative Names
GSTM2;GST4;Glutathione S-transferase Mu 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28161
-
Expression Region
1-218aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPMTLGYWNIRGLAHSIRLLLEYTDSSYEE KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYI ARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQA LPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSTM2, a member of the glutathione S-transferase (GST) family, plays a crucial role in detoxification processes within the body by catalyzing the conjugation of glutathione to various xenobiotic and endogenous compounds. These enzymes are known to protect cells against oxidative stress and contribute to the metabolism of a wide array of substrates, including drugs and carcinogens. The importance of GSTM2 in cellular defense mechanisms has sparked significant research interest, particularly in understanding its role in various diseases, including cancer and neurodegenerative disorders. The recombinant expression of GSTM2 has facilitated the study of its biochemical properties, functional mechanisms, and potential as a therapeutic target. By producing GSTM2 in a recombinant system, researchers can investigate the enzyme's activity, inhibition, and interactions with various ligands, providing insights into its biological significance. Moreover, studying GSTM2 may enhance our understanding of individual variations in drug metabolism and susceptibility to toxicity. Consequently, the research on GSTM2 and its recombinant protein is pivotal for developing strategies for disease prevention and therapeutic interventions, particularly for conditions affected by oxidative stress and detoxification processes.
